PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_15333A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 905aa    MW: 101953 Da    PI: 6.662
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_15333AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.71.5e-142774148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT+eEd +lv  v+++G ++W+  a+  g++Rt+k+c++rw +yl
  Oropetium_20150105_15333A 27 KGPWTEEEDAQLVWFVRLFGERRWDFLAKVSGLKRTGKSCRLRWVNYL 74
                               79********************************************97 PP

2Myb_DNA-binding47.83.4e-1580123146
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                rgr T++E+ l++++++++G++ W++Iar ++ gRt++++k++w++
  Oropetium_20150105_15333A  80 RGRITADEERLILELHAKWGSR-WSRIARSLP-GRTDNEIKNFWRT 123
                                899*******************.*********.***********97 PP

3Myb_DNA-binding53.17.5e-17682729148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                +g+WT+eEd +lv+ v+++G ++W++ a+  g++Rt+k+c++rw +yl
  Oropetium_20150105_15333A 682 KGPWTEEEDARLVRFVRLFGERRWDLLAKVSGLKRTGKSCRLRWVNYL 729
                                79********************************************97 PP

4Myb_DNA-binding48.12.7e-15736778246
                                SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                gr T++E+ l+v++++++G++ W++Iar ++ gRt++++k++w++
  Oropetium_20150105_15333A 736 GRITADEERLIVELHAKWGSR-WSRIARSLP-GRTDNEIKNYWRT 778
                                789******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.2552274IPR017930Myb domain
SuperFamilySSF466893.55E-2725121IPR009057Homeodomain-like
SMARTSM007171.9E-132676IPR001005SANT/Myb domain
PfamPF002495.2E-132774IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-192881IPR009057Homeodomain-like
CDDcd001671.02E-92974No hitNo description
PROSITE profilePS5129423.70875129IPR017930Myb domain
SMARTSM007172.3E-1479127IPR001005SANT/Myb domain
PfamPF002492.6E-1380123IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2182128IPR009057Homeodomain-like
CDDcd001676.28E-1084123No hitNo description
Gene3DG3DSA:3.30.200.209.8E-22378461No hitNo description
SuperFamilySSF561123.24E-82394657IPR011009Protein kinase-like domain
CDDcd066237.19E-147395660No hitNo description
PROSITE profilePS5001147.368397656IPR000719Protein kinase domain
SMARTSM002204.6E-87397656IPR000719Protein kinase domain
PfamPF000694.2E-66399656IPR000719Protein kinase domain
PROSITE patternPS001070403426IPR017441Protein kinase, ATP binding site
Gene3DG3DSA:1.10.510.101.7E-61462663No hitNo description
PROSITE patternPS001080515527IPR008271Serine/threonine-protein kinase, active site
PROSITE profilePS5129422.822677733IPR017930Myb domain
SMARTSM007171.0E-15681731IPR001005SANT/Myb domain
SuperFamilySSF466891.57E-27682776IPR009057Homeodomain-like
PfamPF002493.9E-15682729IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-20683736IPR009057Homeodomain-like
CDDcd001672.17E-11684729No hitNo description
SMARTSM007171.7E-13734782IPR001005SANT/Myb domain
PROSITE profilePS5129417.038734784IPR017930Myb domain
PfamPF002493.0E-13736778IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-21737782IPR009057Homeodomain-like
CDDcd001673.89E-10739778No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006468Biological Processprotein phosphorylation
GO:0007112Biological Processmale meiosis cytokinesis
GO:0010311Biological Processlateral root formation
GO:0009524Cellular Componentphragmoplast
GO:0003677Molecular FunctionDNA binding
GO:0004708Molecular FunctionMAP kinase kinase activity
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 905 aa     Download sequence    Send to blast
MCSSSKNKQG GEQQRSSDTA ATMAMRKGPW TEEEDAQLVW FVRLFGERRW DFLAKVSGLK  60
RTGKSCRLRW VNYLHPGLRR GRITADEERL ILELHAKWGS RWSRIARSLP GRTDNEIKNF  120
WRTRMRKQKA ARQLCGKDDD NTASPSYSSS VTTTTSFSGG GGTATSSSTV TESAQQESSG  180
ENDEAELDEA STTTTTANHQ HHQQQQPQQE CYYTMDQLWN EIAAAEAAAS YTMDSWGIGH  240
AEPPSSMPSS PVWEFCSDYS LWRIDDEEYY KKMLGASPDP VAAAAPSPSR RPTCRLFPPA  300
SPPLLVVPKA TNSGHRASWP SFPPPRGAGT KPVKELKLAV PAQETPVDKF LTASGTFKDG  360
ELRLNQRGLR LISEEDGDEN HSTNLKVEDV QLSMDDLEMI QVIGKGSGGV VQLVRHKWVG  420
TLYALKGIQM NIQEAVRKQI VQELKINQAT QSPHIVMCHQ SFYHNGVIYL VLEYMDRGSL  480
ADIIKQVKTI LEPYLAVLCK QVLEGLLYLH HERHVIHRDI KPSNLLVNRK GEVKITDFGV  540
SAVLASSMGQ RDTFVGTYNY MAPERISGSS YDYKSDIWSL GLVILECAIG RFPYIPSEGE  600
GWLSFYELLE AIVDQPPPSA PADQFSPEFC SFISSCIQKD PAQRMSASEL LAHPFIKKFE  660
DKDLDLRILV EGLEPPMNIP EKGPWTEEED ARLVRFVRLF GERRWDLLAK VSGLKRTGKS  720
CRLRWVNYLH PGLRHGRITA DEERLIVELH AKWGSRWSRI ARSLPGRTDN EIKNYWRTRT  780
RKMALEQRRL QSDSDSKTAS PPSSSVASAG TSSASPTSSS PVTEWVALQL QERSSSEAEL  840
EEASTTTTTV CQHQQQPPYY QVQQEHYCYT VDQLAAVELP SSPVWEFCSD YYSLWRIDDE  900
EYYN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3sls_B7e-7339166621292Dual specificity mitogen-activated protein ki
3sls_A7e-7339166621292Dual specificity mitogen-activated protein ki
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0919170.0FP091917.1 Phyllostachys edulis cDNA clone: bphyem213a09, full insert sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP615144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.33e-54myb domain protein 59